• Open Daily: 10am - 10pm
    Alley-side Pickup: 10am - 7pm

    3038 Hennepin Ave Minneapolis, MN
    612-822-4611

Open Daily: 10am - 10pm | Alley-side Pickup: 10am - 7pm
3038 Hennepin Ave Minneapolis, MN
612-822-4611

Management in 1997

Marketing Your Consulting and Professional Services by Davidson, Jeff, Connor, Dick
Projektleiter in Der Industriellen Forschung Und Entwicklung: Anforderungen Und Erfolg by
Einflußfaktoren Von Alkoholkonsum: Sozialisation, Self-Control Und Differentielles Lernen by
Konfrontation Und Kooperation Im Kalten Krieg: Amerikanische Sicherheitspolitik 1950 Bis 1956 by
Stop Telling, Start Selling: How to Use Customer-Focused Dialogue to Close Sales by Richardson, Linda
Lega Nord Im Politischen System Italiens: Produkt Und Profiteur Der Krise by
Individuelle Erwerbschancen in Ostdeutschland: Auswirkungen Des Wirtschaftsstrukturellen Wandels by
Übergänge Der Freiheit: Die Nicaraguanische Revolution Und Ihr Historisch-Politischer Übertragungsraum by
Mediale Konstruktion Politischer Realität: Politikvermittlung Im Zeitalter Der Fernsehdemokratie by Ruberto, Rosaia, Jansen, Andrea
Orte Des Politischen: Politik, Hegemonie Und Ideologie Im Marxismus by
Spontanes Versus Reflektiertes Sprachverstehen by
Das Waffenregister Der Vereinten Nationen: Ziele Und Probleme Internationaler Rüstungssteuerung by
Kundenorientierte Workflowprojekte: Ein Pragmatischer Leitfaden by
Managing the Aftermath of Radical Corporate Change: Reengineering, Restructuring, and Reinvention by Geisler, Eliezer
Creating Technology Strategies: How to Build Competitive Biomedical R&d by Sapienza, Alice M.
Bilanzanalyse by Rehkugler, Heinz
Industrial Engineering Projects: Practice and procedures for capital projects in the engineering, manufacturing and process industries by
Work and Pay in the United States and Japan by Nakata, Yoshifumi, Brown, Clair, Stern, David
Art of the Long View by Schwartz, Peter
Organisationsstrukturen Und Informationssysteme Auf Dem Pra1/4fstand: 18. Saarbra1/4cker Arbeitstagung 1997 Fa1/4r Industrie, Dienstleistung Und Verwa by
Making Common Sense Common Practice: Achieving High Performance Using What You Already Know by Buzzotta, Victor R.
New Operational Approaches for Financial Modelling by
Erfolg Durch Vertrauen: Abschied Vom Management Des Mißtrauens by
Gabler Volkswirtschafts Lexikon by
Zukunftssicherung Für Die Bauwirtschaft: In Vier Schritten Aus Der Krise by Weissman, Arnold, Schmutzer, Michael O.
Bausteine Für Ein Zukunftsfähiges Deutschland: Diskursprojekt Im Auftrag Von VCI Und Ig Chemie-Papier-Keramik by
Strategic Decisions by
From the Universities to the Marketplace: The Business Ethics Journey: The Second Annual International Vincentian Conference Promoting Business Ethics by
Corporate Transformation by
The Path to European Economic and Monetary Union by Rehman, Scheherazade S.
The Instant Trainer: Quick Tips on How to Teach Others What You Know by Clarke-Epstein, Chris, Charles, C. Leslie
The Enterprising Woman by Florence, Mari
Managing the Design Factory by Reinertsen, Donald
Strategy in Crisis: Why Business Needs a Completely New Approach by Kare-Silver, Michaelg de
Strategisches Personalmanagement Für Die Öffentliche Verwaltung: Erfolgs- Und Mißerfolgsfaktoren Im Reformprozeß by Korintenberg, Werner
Aspekte Der Personalentwicklung in Der Öffentlichen Verwaltung by Buck, Dieter, Jäger, Wieland
Informationstechnik-Basierte Referenzprozesse: Prozeßorientierte Gestaltung Des Industriellen Einkaufs by
Kreditderivate Im Europäischen Kapitalmarkt by Hüttemann, Petra
Napoleon Hill's Keys to Success: The 17 Principles of Personal Achievement by Hill, Napoleon
Corporate Governance: Economic and Financial Issues by
Corporate Governance: Economic and Financial Issues by
Managing Knowledge: Experts, Agencies and Organisations by Bradley, Keith, Albert, Steven
Coping with Recession: UK Company Performance in Adversity by Geroski, Paul A., Gregg, Paul
Coping with Recession: UK Company Performance in Adversity by Gregg, Paul, Geroski, Paul A.
Managing Knowledge: Experts, Agencies and Organisations by Albert, Steven, Bradley, Keith
The Transformational Leader: The Key to Global Competitiveness by Devanna, Mary Anne, Tichy, Noel M.
Managing Ambiguity and Change: The Case of the Nhs by Dopson, S.
Managing Ambiguity and Change: The Case of the Nhs by Dopson, S.
The Fast Track: The Insider's Guide to Winning Jobs in Management Consulting, Investment Banking & Securities Trading by Naficy, Mariam
Multimethodology: Towards Theory and Practice and Mixing and Matching Methodologies by
Paradoxes of Group Life: Understanding Conflict, Paralysis, and Movement in Group Dynamics by Smith, Kenwyn K., Berg, David N.
Strategische Allianzen in der Kreditwirtschaft by Knoppe, Marc
Teilgewinnrealisierung bei Auftragsfertigung by Lorchheim, Ulrich, Selchert, Friedrich W.
Gung Ho!: Turn on the People in Any Organization by Blanchard, Ken
Contracting for Change: Contracts in Health, Social Care, and Other Local Government Services by Deakin, Nicholas
The Case for Human Factors in Industry and Government: Report of a Workshop by Division of Behavioral and Social Sciences and Education, Board on Human-Systems Integration, National Research Council
Globalisierung: Der Schritt in Ein Neues Zeitalter by
Innovationsdarlehen ALS Instrument Zur Förderung Kleiner Und Mittlerer Unternehmen: Evaluierung Des Fue-Darlehensprogramms Für Kleine Unternehmen Zur by Broß, Ulrike, Gundrum, Uwe, Kulicke, Marianne
Internationale Marketing-Politik by Berndt, Ralph, Fantapie Altobelli, Claudia, Sander, Matthias
Produktionsplanung: Ablauforganisatorische Aspekte by Scholl, Armin, Voß, Stefan, Domschke, Wolfgang
Guerrilla Marketing with Technology Unleashing the Full Potential of Your Small Business by Levinson, Jay Conrad
Hierarchische Produktionsplanung Für Die Marktorientierte Serienfertigung: Anwendung Auf Ein Unternehmen Der Elektrotechnischen Industrie by Meyer, Robert
Teamguides: A Self-Directed System for Teams by Humphrey, Brad, Stokes, Jeff
Das Managementmodell Der Jesuiten: Ein Erfolgskonzept Für Das 21. Jahrhundert by Geiselhart, Helmut
Wahlrechtsproblematik Der Konzernrechnungslegung by
Kapazitätsmanagement in Dienstleistungsunternehmungen: Grundlagen Und Gestaltungsmöglichkeiten by
Vom Business Process Reengineering Zum Change Management: Kritische Bestandsaufnahme, Perspektiven Und Erfahrungen by
Sequentielle Nicht-Lineare Tarife: Nicht-Lineare Preispolitik Bei Nachfrageunsicherheit by Büschken, Joachim
Strategic Planning: A Practical Guide by Rea, Peter J., Kerzner, Harold
Regionalisierung Und Interkommunale Zusammenarbeit: Wirtschaftsregionen ALS Instrumente Kommunaler Wirtschaftsförderung by
Steuerung Im Internationalen Produktionsverbund Mit Güternetzwerken by
Immobilienmakler Und Neue Institutionenökonomik by
Kompensation Von Zinsänderungs- Und Währungsrisiken in Der Bankbilanz by
Internet Und Strategisches Umweltmanagement: Krisenabwehr Durch Stakeholder-Orientierte Kommunikation by
Lieferserviceorientierte Distributionslogistik: Fallstudienbasierte Untersuchung in Der Bauzulieferindustrie by
Produktivitätsorientiertes Management Von Anlagensystemen by
Werkzeuge Für Die Moderatorlose Gruppenarbeit: Konzeption -- Realisierung -- Einsatzpotentiale by
Betriebliches Informationsmanagement: Flexibilisierung Der Informationsinfrastruktur by
Groupware Enabled Data Warehouse: Management Support Für Prüfungs- Und Beratungsgesellschaften by
Differenziertes Human Resource Management: Lösungsansatz Für Die Geschlechtergleichstellung by
Marktstrategien Im Großhandel: Bausteine Des Unternehmenserfolgs by
Dezentrale Pps-Systeme by Ramsauer, Christian
Betriebliche Umweltinformationssysteme: Gestaltung Und Implementierung Eines Buis-Kernsystems by Arndt, Hans-Knud
Multivariate Werbewirkungskontrolle: Konzepte Zur Auswertung Von Werbetests by Schwaiger, Manfred
Beziehungsmanagement Im Personalwesen Von Banken: Studierende Ehemalige Auszubildende ALS Zielgruppe by Stein, Stefan
Managing Pension Plans: A Comprehensive Guide to Improving Plan Performance by Logue, Dennis E.
Insights on Leadership: Service, Stewardship, Spirit, and Servant-Leadership by
Handelsforschung 1997/98: Kundenorientierung Im Handel by
Planung Von Puffern Und Durchlaufzeiten: Zeitbezogene Ansätze Der Lagerhaltungstheorie by
Entscheidungsunterstützung Zur Fue-Programmplanung by
Eigentum Und Strategisches Management: Eine Systemtheoretische Perspektive Für Die Mittelständische Familienunternehmung by
Derivatepublizität Von Kreditinstituten Im Kontext Wirtschaftlicher Stabilität by
Strategien Von Banken Im Globalen Wettbewerb by
Zwischenbetriebliche Logistikleistungen in Der Industrie: Produktion Und Absatz Investiver Dienstleistungen by
Anforderungen Deutscher Unternehmen an Betriebswirtschaftliche Hochschulabsolventen: Zur Marktorientierung Von Hochschulen by
Transrapid Zwischen Ökonomie Und Ökologie: Eine Technikwirkungsanalyse Alternativer Hochgeschwindigkeitsverkehrssysteme by
Mit Dem Körper Sprechen by Mühlisch, Sabine
Coping with Cutbacks: The Nonprofit Guide to Success When Times Are Tight by Angelica, Emil, Hyman, Vincent
Coping with Cutbacks: The Nonprofit Guide to Success When Times Are Tight by Angelica, Emil, Hyman, Vincent
Auswirkungen von Executive Information Systems (EIS) auf Organisationen aus mikropolitischer Sicht by Thönneßen, Rolf
Teams at the Top by Katzenbach, Jon R.
Öffentlichkeit, Diskurs Und Gesellschaft: Zum Analytischen Potential Und Zur Kritik Des Begriffs Der Öffentlichkeit Bei Habermas by
Jugendfernsehen Auf Dem Weg Vom Infotainment Zum Infomercial: Die Magazine "Elf 99" Und "Saturday" Zwischen Wende Und Wiedervereinigung by
Supervision Von Verhaltenstherapien: Eine Längsschnittstudie Zur Entwicklung Von Therapeuten by
Elektrosmog Kontrovers: Umgang Mit Gesundheitlichen Risiken in Wissenschaft Und Gesellschaft by
Kommunikation Und Unternehmerischer Wandel by
Die Regionalisierung Von Innovationsprozessen in Der Informationstechnologie: Staatliche Forschungsförderung Im Zeitalter Der Globalisierung by
Putting Emotional Intelligence To Work by Ryback, David
Making Strategy Work: Building Sustainable Growth Capability by Galpin, Timothy J.
Choosing the Future: The Power of Strategic Thinking by Wells, Stuart
Der Einfluß des kulturellen und sozialen Kapitals auf die Personalrekrutierung by Puma, Jörg U.
Global Tourism and Informal Labour Relations: The Small Scale Syndrome at Work by Baladacchino, Godfrey
Marianne Ehrmann: Publizistin Und Herausgeberin Im Ausgehenden 18. Jahrhundert by
Politische Steuerung Im Arbeitsschutz: Einsatzbedingungen Der Lasertechnik in Der Industriellen Materialbearbeitung by
Italien Zwischen Zentralismus Und Föderalismus: Dezentralisierung Und Nord-Süd-Konflikt by
Datenkonsistenz Bei Heterogener Datenspeicherung: Konzept Und Prototypische Realisierung by
Ökomanagement im Tourismus by Viegas, Angela
Die Intelligente Unternehmung: Management Von Information, Wissen Und Werten by
Human Resource Management in Der Öffentlichen Verwaltung by
Einsatzpotentiale Von Virtueller Realität Im Marketing by
Kulturelle Identität, Soziale Netzwerke Und Kognition: Berichte Ethnologischer Forschungen Aus Köln by
Total Productivity Management (TPmgt): A Systemic and Quantitative Approach to Compete in Quality, Price and Time by Sumanth, David J.
Regionale Integration: Eine Eigenständige Liberalisierungsstrategie Für Die Weltwirtschaft by
Strategic Management in a Hostile Environment: Lessons from the Tobacco Industry by Jones, Raymond
Lernen Der Organisation Durch Gruppen- Und Teamarbeit: Wettbewerbsvorteile Durch Umfassende Unternehmensplanung by
If You're Not Out Selling, You're Being Outsold by St Lawrence, Michael, Johnson, Steve
Revolutionizing Workforce Performance: A Systems Approach to Mastery by Bowsher, Jack E.
Catalytic Leadership: Strategies for an Interconnected World by Luke, Jeffrey S.
Crossing Boundaries: Collaboration, Coordination, and the Redefinition of Resources by Lorentz, Elizabeth M., Sarason, Seymour B.
Intellectual Capital: Navigating the New Business Landscape by Roos, Johan, Edvinsson, Leif, Dragonetti, Nicola C.
Virtual Organizations and Beyond: Discovering Imaginary Systems by Hedberg, Bo, Dahlgren, Göran, Hansson, Jörgen
Confronting Company Politics by Stone, B.
Managing and Modelling Complex Projects by
Competing Through Supply Chain Management: Creating Market-Winning Strategies Through Supply Chain Partnerships by Ross, David F.
Strategy in Crisis: Why Business Urgently Needs a Completely New Approach by Loparo, Kenneth A.
Discretionary Managerial Behavior by Rao, T. V. S. Ramamohan, Rastogi, Ranjul
Computer Applications in Production and Engineering: Ifip Tc5 International Conference on Computer Applications in Production and Engineering (Cape '9 by
Cooperation in Research and Development by Vonortas, Nicholas S.
How to Start a Successful Home Business by Cheney, Karen, Alderman, Lesley
The Greatest Sales Stories Ever Told: From the World's Best Salespeople by Shook, Robert
Safety Is a People Business: A Practical Guide to the Human Side of Safety by Manning, Michael V.
Profit from Time: Speed Up Business Improvement by Implementing Time Compression by Gregory, Ian C., Rawling, Simon B.
New Dimensions in Investor Relations: Competing for Capital in the 21st Century by Marcus, Bruce W., Wallace, Sherwood Lee
Prozeßorientiertes Qualitätscontrolling: Qualität Meßbar Machen by
Empirische Studie bei Kraft Jacobs Suchard zur Implementierung und Weiterentwicklung der betrieblichen Gesundheitsförderung in die Personal- und Organ by Czalnik, Iris
The Open-Book Management Field Book by Kane, M. Patricia, Schuster, John P., Carpenter, Jill
Re-Wiring Business: Uniting Management and the Web by McEachern, Tim, O'Keefe, Bob
Kriterienorientierter Vergleich von Kooperationsformen für Freiberufler mit wirtschaftsberatender Tätigkeit by Müller, Alexander
Learning from the Future: Competitive Foresight Scenarios by
Wissensmanagement in lernenden Unternehmen by Rudolf, Frank
Zapp! the Lightning of Empowerment: How to Improve Quality, Productivity, and Employee Satisfaction by Cox, Jeff, Byham, William
Becoming Lean: Inside Stories of U.S. Manufacturers by Liker, Jeffrey K.
Japanese Business Management: Restructuring for Low Growth and Globalisation by
Unternehmenserfolg und Innovationstätigkeit: Eine empirische Untersuchung der Innovationsprozesse von Unternehmen mit überdurchschnittlich hohem, prof by Bauer, Ralf
Benchmarking: Eine kritische Betrachtung by Gnosa, Gerd
Understanding Green Consumer Behaviour: A Qualitative Cognitive Approach by Wagner, Sigmund A.
Smart Moves: 140 Checklists to Bring Out the Best from You and and Your Team, Revised Edition by Sussman, Lyle, Deep, Sam
Internationale Kunden-Lieferanten-Beziehungen: Determinanten - Steuerungsmechanismen - Beziehungsqualität by Kiedaisch, Ingo
Strategische Kostenrechnung: Einsatzmöglichkeiten Und Grenzen by Baden, Axel
Marketing Strategy by Schnaars, Steven P.
Semantische Geschäftsprozeßintegration by
Management Internationaler Raumfahrtprojekte by
Entrepreneurship ALS Ökonomischer Prozeß: Perspektiven Zur Förderung Unternehmerischen Handelns by
Bildung Von Kreditnehmereinheiten Gemäß § 19 Abs. 2 Kwg: Auswirkungen Auf Die Bonitätsprüfung by
Strategisches It-Management in Internationalen Unternehmungen by
Gestaltung Der Planung: Konzeptioneller Ansatz Und Fallstudien by Goeldel, Hanns
Umweltwahrscheinlichkeitshaftung: Konzept Für Kausalität Und Zurechnung Im Umwelthaftungsrecht by
Outsourcing Der Datenverarbeitung: Empirische Untersuchung Und Gestaltungsempfehlungen by
Futureshedging Auf Ölmärkten: Die Öl-Geschäftsstrategie Der Metallgesellschaft by
Die Entwicklung Des Kombinierten Verkehrs: Ein Trajekt Im Eisenbahnparadigma by
Institutionen Der Außeruniversitären Grundlagenforschung: Eine Analyse Der Kaiser-Wilhelm-Gesellschaft Und Der Max-Planck-Gesellschaft by
Erlebniswelten Und Stimmungen in Der Anzeigenwerbung: Analyse Emotionaler Werbebotschaften by Woll, Erika
Werbemonitoring: Computergestütztes Verfahren Zur Konkurrenzanalyse by
Wirtschaftlichkeit Des Qualitätsmanagements: Qualitätscontrolling Für Dienstleistungen by Bruhn, Manfred
Informationstechnik Für Den Privaten Haushalt: Anwendungen Und Infrastrukturen by Kolbe, Lutz M.
Controlling-Servicegesellschaften für Kleine und Mittlere Unternehmungen by Pagel, Sven
Grundsätze Ordnungsmäßiger Umwandlungsprüfung by
Der Neoliberale Staat: Entwicklung Einer Zukunftsfähigen Staatstheorie by
Finanzmanagement, Band 1: Problemorientierte Einführung by Dettmer, Harald, Hausmann, Thomas
Inkrementelle Und Objektorientierte Vorgehensweisen Mit Dem V-Modell 97 by
Routledge Spanish Dictionary of Business, Commerce and Finance Diccionario Ingles de Negocios, Comercio y Finanzas: Spanish-English/English-Spanish by Castro, Emilio G. Muniz
Vergleich Der Kommunen in Deutschland Und Frankreich Im Föderalen Und Zentralen System: Historische, Rechtliche Und Finanzielle Aspekte by
Fachkonzept Für Ein Integriertes Produktions-, Recyclingplanungs- Und Steuerungssystem (Prps-System) by Rautenstrauch, Claus
Strategy Pure & Simple II: How Winning Companies Dominate Their Competitors by Robert, Michel
Using Conflict in Organizations by
Using Conflict in Organizations by
The Organisation of Integrated Product Development by Paashuis, Victor
Improving Organizational Performance: A Practical Guidebook for the Human Services Field by Sluyter, Gary V.
Kundeneinbindung in Den Produktinnovationsprozeß: Bestandsaufnahme, Determinanten Und Erfolgsauswirkungen by Gruner, Kjell E.
Wirtschafts- Und Sozialkunde Für Versicherungsfachangestellte: Gezielte Prüfungsvorbereitung Durch Aufgaben Und Fälle Mit Lösungen by Hau, Werner
Controllinggestütztes Produktmanagement: Integration Von Produktplanung Und Ergebnisbezogenem Rechnungswesen by Klein, Andreas
Reducing Project Risk by Ludin, Irwin S., Kliem, Ralph L.
Optimale Standortwahl Im Einzelhandel: Den Wettbewerb Um Den Kunden Gewinnen by
Should 360-degree Feedback Be Used Only for Developmental Purposes? by
Customer Loyalty Pyramid by Lowenstein, Michael W.
Probabilistic Risk Assessment of Engineering Systems by Melchers, Robert E., Stewart, M.
Key Qualifications in Work and Education by
Winning Airlines: Productivity and Cost Competitiveness of the World's Major Airlines by Tae Hoon Oum, Chunyan Yu
The Complete Sales Letter Book: Model Letters for Every Selling Situation: Model Letters for Every Selling Situation by Harris, Jonathan, McIntyre, Ann
EDI and Data Networking in the Public Sector by
See More